Loading...
Statistics
Advertisement

 
www.ziyye.com/

Ziyye.com

Advertisement
Conversion Technology Metas Server
Ziyye.com is hosted in United States / Ashburn . Ziyye.com doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Google Font API, Html, Number of used javascripts: 1. First javascripts: Loader.js, Number of used analytics tools: 0. Its server type is: .

Technologies in use by Ziyye.com

Technology

Number of occurences: 4
  • CSS
  • Google Font API
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 1
  • loader.js

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Ziyye.com

Missing HTTPS protocol.

    Meta - Ziyye.com

    Number of occurences: 2
    • Name:
      Content: text/html; charset=utf-8
    • Name: viewport
      Content: width=device-width, initial-scale=1, user-scalable=no shrink-to-fit=no

    Server / Hosting

    • IP: 52.0.217.44
    • Latitude: 39.05
    • Longitude: -77.47
    • Country: United States
    • City: Ashburn

    Rname

    • ns1.dynadot.com
    • ns2.dynadot.com

    Target

    • hostmaster.ziyye.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Sat, 20 Aug 2016 11:37:47 GMT Content-Length: 769 Cache-Control: private, no-cache, no-store, max-age=0 Expires: Mon, 01 Jan 1990 0:00:00 GMT X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.16) Connection: keep-alive

    DNS

    host: ziyye.com
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 52.0.217.44
    host: ziyye.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns1.dynadot.com
    host: ziyye.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns2.dynadot.com
    host: ziyye.com
    1. class: IN
    2. ttl: 2560
    3. type: SOA
    4. mname: ns1.dynadot.com
    5. rname: hostmaster.ziyye.com
    6. serial: 1471692759
    7. refresh: 16384
    8. retry: 2048
    9. expire: 1048576
    10. minimum-ttl: 2560

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.iyye.com, www.ztiyye.com, www.tiyye.com, www.zaiyye.com, www.aiyye.com, www.zsiyye.com, www.siyye.com, www.zxiyye.com, www.xiyye.com, www.zciyye.com, www.ciyye.com, www.zgiyye.com, www.giyye.com, www.zhiyye.com, www.hiyye.com, www.zjiyye.com, www.jiyye.com, www.zuiyye.com, www.uiyye.com, www.zyye.com, www.ziryye.com, www.zryye.com, www.zifyye.com, www.zfyye.com, www.zivyye.com, www.zvyye.com, www.zikyye.com, www.zkyye.com, www.zi,yye.com, www.z,yye.com, www.zibyye.com, www.zbyye.com, www.zigyye.com, www.zgyye.com, www.zityye.com, www.ztyye.com, www.ziyyye.com, www.zyyye.com, www.ziuyye.com, www.zuyye.com, www.zijyye.com, www.zjyye.com, www.zimyye.com, www.zmyye.com, www.zinyye.com, www.znyye.com, www.ziye.com, www.ziyzye.com, www.zizye.com, www.ziyaye.com, www.ziaye.com, www.ziysye.com, www.zisye.com, www.ziydye.com, www.zidye.com, www.ziyye.com, www.ziye.com, www.ziycye.com, www.zicye.com, www.ziy ye.com, www.zi ye.com, www.ziye.com, www.ziyyze.com, www.ziyze.com, www.ziyyae.com, www.ziyae.com, www.ziyyse.com, www.ziyse.com, www.ziyyde.com, www.ziyde.com, www.ziyye.com, www.ziye.com, www.ziyyce.com, www.ziyce.com, www.ziyy e.com, www.ziy e.com, www.ziyy.com, www.ziyyex.com, www.ziyyx.com, www.ziyyes.com, www.ziyys.com, www.ziyyew.com, www.ziyyw.com, www.ziyyer.com, www.ziyyr.com, www.ziyyef.com, www.ziyyf.com, www.ziyyev.com, www.ziyyv.com, www.ziyyec.com, www.ziyyc.com, www.ziyyeq.com, www.ziyyq.com, www.ziyyea.com, www.ziyya.com, www.ziyyey.com, www.ziyyy.com,

    Other websites we recently analyzed

    1. Aeroneb Medikamentenvernebler - INSPIRATION Medical GmbH
      INSPIRATION Medical präsentiert auf aeroneb.de Medikamentenvernebler. Aeroneb Go - Aeroneb Pro - Aeroneb Solo
      Germany - 217.160.36.196
      Server software: Apache
      Technology: CSS, Html, Javascript, Swf Object
      Number of Javascript: 4
      Number of meta tags: 8
    2. Willkommen auf der Homepage von
      Switzerland - 80.74.155.167
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    3. kalley-uk.net
      Switzerland - 141.8.225.31
      Server software: Apache
      Technology: Html
    4. Ansambel Neljapäev
      Neljapäev on eesti- ja ingliskeelset kergemat tantsulist rokkmuusikat viljelev ansambel.
      Estonia - 195.222.15.76
      Server software: Apache
      Technology: CSS, Html, Iframe, Javascript, jQuery Colorbox, Php, Google Analytics, Facebook Like box
      Number of Javascript: 2
      Number of meta tags: 2
    5. 60 Sekunden Optionen
      60 Sekunden Optionen Tool gratis 30 Tage testen
      Germany - 85.13.140.187
      Server software: Apache
      Technology: CSS, Html, Javascript
      Number of meta tags: 25
    6. naxal.ru - Diese Website steht zum Verkauf! - Informationen zum Thema naxal.
      Diese Website steht zum Verkauf! naxal.ru ist Ihre erste und beste Informationsquelle über naxal Hier finden Sie auch weitere interessante Links. Wir hoffen, dass Sie bei Ihrer Suche erfolgreich sind!
      Germany - 82.98.86.169
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    7. 介護資格≪おすすめ求人≫
      今から介護資格を取りにいこうと思ってます。
      Osaka (Japan) - 112.78.200.16
      Server software: LiteSpeed
      Technology: CSS, Html
      Number of meta tags: 3
    8. Psychiatry Port Orange, Florida
      Psychiatrist, Psychiatry, Therapy, Counseling, Psychotherapy, Depression, Anxiety, ADHD, Obsessive Compulsive Disorder, Stress Management, OCD, PTSD
      Ashburn (United States) - 54.236.189.61
      G Analytics ID: UA-49148900-1
      Server software: openresty/1.7.4.1
      Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Google Analytics
      Number of Javascript: 10
      Number of meta tags: 4
    9. keechains.org
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    10. kellerwilliamsrealtyservices.com
      Chicago (United States) - 184.154.247.147
      Server software: nginx
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Php, Pingback, Shortcodes, Wordpress
      Number of Javascript: 22
      Number of meta tags: 3

    Check Other Websites